PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca27365.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 281aa    MW: 31167.8 Da    PI: 7.7118
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca27365.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.4e-18211244134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  Dca27365.1 211 CRHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 244
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.1E-705279IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.174205241IPR000679Zinc finger, GATA-type
SMARTSM004019.2E-17205255IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.18E-15209268No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14209243IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.30E-13210257No hitNo description
PROSITE patternPS003440211236IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15211244IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MRNLVEINNM VGEIDCGNFF DQIDDFLDFP NDNTVDTGVF GSSRPVDCAT FPCVWSDNSP  60
DFSVVQSHNQ SASHLSAELS VPYEDIVQLE WLSTFVEDSF SSGGLTLEKS YTTSSSDKEY  120
SLRNQFQTSS SSSVLDSNTS ACSRPQLLPV SHEKRARSKR PRPAAFTPRP SFELVQKKRK  180
IRILPMSGGS DGTIHNQNED PNNAGAPVRK CRHCEITKTP QWRAGPMGPK TLCNACGVRY  240
KSGRLYPEYR PAASPTFVPS LHSNSHKKVL EMRGCNPKPE A
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158162KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683872.11e-111PREDICTED: GATA transcription factor 8
TrEMBLA0A0J8C2J71e-111A0A0J8C2J7_BETVU; Uncharacterized protein
STRINGPOPTR_0010s23010.15e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.28e-40GATA family protein